| Edit |   |
| Antigenic Specificity | Wnt-2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Wnt-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Wnt-2. This antibody reacts with mouse. The Wnt-2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Wnt2 - C-terminal region. Peptide sequence RKYNGAIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDREAG. |
| Other Names | INT1L1secreted growth factor, Int-1-like protein 1, Int-1-related protein, IRPprotein Wnt-2, wingless-type MMTV integration site family member 2 |
| Gene, Accession # | WNT2, Gene ID: 7472, Accession: NP_076142 |
| Catalog # | NBP1-98349-20ul |
| Price | |
| Order / More Info | Wnt-2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |