| Edit |   |
|---|
| Antigenic Specificity | SFXN1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SFXN1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SFXN1. This antibody reacts with human. The SFXN1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SFXN1(sideroflexin 1) The peptide sequence was selected from the N terminal of SFXN1. Peptide sequence MSGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKI. |
|---|
| Other Names | FLJ12876, sideroflexin 1, sideroflexin-1, TCC, Tricarboxylate carrier protein |
|---|
| Gene, Accession # | SFXN1, Gene ID: 94081, Accession: Q9H9B4, SwissProt: Q9H9B4 |
|---|
| Catalog # | NBP1-59615-20ul |
|---|
| Price | |
|---|
| Order / More Info | SFXN1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|