| Edit |   |
|---|
| Antigenic Specificity | SFXN4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 50 ul |
|---|
| Concentration | lyophilized |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SFXN4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SFXN4. This antibody reacts with human. The SFXN4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SFXN4 (sideroflexin 4) The peptide sequence was selected from the N terminal of SFXN4. Peptide sequence: MSLEQEEETQPGRLLGRRDAVPAFIEPNVRFWITERQSFIRRFLQWTELL. |
|---|
| Other Names | BCRM1, Breast cancer resistance marker 1, sideroflexin 4, sideroflexin-4 |
|---|
| Gene, Accession # | SFXN4, Gene ID: 119559, Accession: Q6P4A7, SwissProt: Q6P4A7 |
|---|
| Catalog # | NBP2-41354 |
|---|
| Price | |
|---|
| Order / More Info | SFXN4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|