| Edit |   |
| Antigenic Specificity | SGEF |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SGEF Antibody from Novus Biologicals is a rabbit polyclonal antibody to SGEF. This antibody reacts with human. The SGEF Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SGEF(Src homology 3 domain-containing guanine nucleotide exchange factor) The peptide sequence was selected from the N terminal of SGEF. Peptide sequence MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLIT |
| Other Names | Rho guanine nucleotide exchange factor (GEF) 26 |
| Gene, Accession # | ARHGEF26, Gene ID: 26084 |
| Catalog # | NBP1-70702 |
| Price | |
| Order / More Info | SGEF Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |