| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SGLT2/SLC5A2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, WB reactivity reported in scientific literature (PMID: 25894829). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SGLT2/SLC5A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SGLT2/SLC5A2. This antibody reacts with human. The SGLT2/SLC5A2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SGLT2/SLC5A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL |
|---|
| Other Names | Low affinity sodium-glucose cotransporter, Na(+)/glucose cotransporter 2, SGLT2sodium/glucose cotransporter 2, solute carrier family 5 (sodium/glucose cotransporter), member 2, solute carrier family 5 (sodium/glucose transporter), member 2, Solute carrier family 5 member 2 |
|---|
| Gene, Accession # | SLC5A2, Gene ID: 6524 |
|---|
| Catalog # | NBP1-92384 |
|---|
| Price | |
|---|
| Order / More Info | SGLT2/SLC5A2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25894829, 30429355 |
|---|
| 产品资料 |
|
|