| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SGLT3/SLC5A4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SGLT3/SLC5A4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SGLT3/SLC5A4. This antibody reacts with human. The SGLT3/SLC5A4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC5A4(solute carrier family 5 (low affinity glucose cotransporter), member 4) (NP_055042). The peptide sequence was selected from the N terminal of SLC5A4. Peptide sequence MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAV |
|---|
| Other Names | DJ90G24.4, low affinity sodium-glucose cotransporter, Na(+)/glucose cotransporter 3, SAAT1low affinity sodium glucose cotransporter, SGLT2, SGLT3, sodium transporter, Sodium/glucose cotransporter 3, solute carrier family 5 (low affinity glucose cotransporter), member 4, solute carrier family 5 (neutral amino acid transporters, system A), member 4, Solute carrier family 5 member 4 |
|---|
| Gene, Accession # | SLC5A4, Gene ID: 6527, Accession: Q9NY91, SwissProt: Q9NY91 |
|---|
| Catalog # | NBP1-59886 |
|---|
| Price | |
|---|
| Order / More Info | SGLT3/SLC5A4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|