| Edit |   |
|---|
| Antigenic Specificity | MS4A14 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-MS4A14 Antibody |
|---|
| Immunogen | The immunogen for anti-NYD-SP21 antibody: synthetic peptide directed towards the middle region of human NYD-SP21. Synthetic peptide located within the following region: QYPEGQSKDGQVKDQQTDKEQNSKKQTQDQQTEDQPAQEKKSPKGQFQNV |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | M4A14, Accession: NM_032597 |
|---|
| Catalog # | TA339616 |
|---|
| Price | |
|---|
| Order / More Info | MS4A14 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|