| Edit |   |
| Antigenic Specificity | MS4A6E |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-MS4A6E Antibody |
| Immunogen | The immunogen for Anti-MS4A6E Antibody is: synthetic peptide directed towards the middle region of Human MS4A6E. Synthetic peptide located within the following region: FILLSVNPAALNPASLQCKLDEKDIPTRLLLSYDYHSPYTMDCHRAKASL |
| Other Names | membrane-spanning 4-domains, subfamily A, member 6E |
| Gene, Accession # | M4A6E, Accession: NM_139249 |
| Catalog # | TA331660 |
| Price | |
| Order / More Info | MS4A6E Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |