| Edit |   |
|---|
| Antigenic Specificity | ARL16 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARL16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARL16. This antibody reacts with human. The ARL16 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ARL16 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TQLSASCVQLLGLLSAEQLAEASVLILFNKIDLPCYMSTEEMKSLIRLPDIIACAKQNITTAEISAREGTGLAGVLAWLQATHRAND |
|---|
| Other Names | ADP-ribosylation factor-like 16, ADP-ribosylation factor-like protein 16 |
|---|
| Gene, Accession # | ARL16, Gene ID: 339231, Accession: Q0P5N6, SwissProt: Q0P5N6 |
|---|
| Catalog # | NBP1-94157 |
|---|
| Price | |
|---|
| Order / More Info | ARL16 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|