| Edit |   |
| Antigenic Specificity | ARL17 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ARL17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARL17. This antibody reacts with human. The ARL17 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ARL17(ADP-ribosylation factor-like 17) The peptide sequence was selected from the middle region of ARL17 (NP_001034172). Peptide sequence KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD. |
| Other Names | ADP-ribosylation factor-like 17B, ADP-ribosylation factor-like protein 17, ADP-ribosylation factor-like protein 7, ARL17A, ARL17B |
| Gene, Accession # | ARL17B, Gene ID: 100506084, Accession: Q8IVW1, SwissProt: Q8IVW1 |
| Catalog # | NBP1-70411 |
| Price | |
| Order / More Info | ARL17 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |