| Edit |   |
|---|
| Antigenic Specificity | Adenosine A2b R |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot. Recommended positive control: 293T cell lysate. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Adenosine A2b R Antibody from Novus Biologicals is a rabbit polyclonal antibody to Adenosine A2b R. This antibody reacts with human. The Adenosine A2b R Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ADORA2B (adenosine A2b receptor) The peptide sequence was selected form the C terminal of ADORA2B. Peptide sequence AKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHAN. |
|---|
| Other Names | adenosine A2b receptor, adenosine receptor A2b, ADORA2 |
|---|
| Gene, Accession # | ADORA2B, Gene ID: 136, Accession: P29275, SwissProt: P29275 |
|---|
| Catalog # | NBP1-68953 |
|---|
| Price | |
|---|
| Order / More Info | Adenosine A2b R Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|