| Edit |   |
| Antigenic Specificity | Adenosylhomocysteinase/AHCY |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Adenosylhomocysteinase/AHCY Antibody from Novus Biologicals is a rabbit polyclonal antibody to Adenosylhomocysteinase/AHCY. This antibody reacts with human. The Adenosylhomocysteinase/AHCY Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to AHCY(S-adenosylhomocysteine hydrolase) The peptide sequence was selected from the N terminal of AHCY. Peptide sequence SDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIA. |
| Other Names | adenosylhomocysteinase, AdoHcyase, EC 3.3.1.1, S-adenosylhomocysteine hydrolase, S-adenosyl-L-homocysteine hydrolase, SAHHadoHcyase |
| Gene, Accession # | AHCY, Gene ID: 191, Accession: P23526, SwissProt: P23526 |
| Catalog # | NBP1-55016 |
| Price | |
| Order / More Info | Adenosylhomocysteinase/AHCY Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |