| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DDX11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DDX11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DDX11. This antibody reacts with human. The DDX11 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DDX11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQKKEERDLV |
|---|
| Other Names | CHL1CHL1-related helicase gene-1, CHL1-related protein 1, CHLR1MGC9335, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (CHL1-like helicase homolog, S.cerevisiae), DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (S.cerevisiae CHL1-likehelicase), DEAD/H box protein 11, EC 3.6.1, EC 3.6.1.23, EC 3.6.1.7, EC 3.6.4.13, hCHLR1, Keratinocyte growth factor-regulated gene 2 protein, KRG-2, KRG2CHL1-like helicase homolog, MGC133249, probable ATP-dependent RNA helicase DDX11 |
|---|
| Gene, Accession # | DDX11, Gene ID: 1663, Accession: Q96FC9, SwissProt: Q96FC9 |
|---|
| Catalog # | NBP2-38060 |
|---|
| Price | |
|---|
| Order / More Info | DDX11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|