| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DDX43 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 24755885). For IHC-Paraffin, HIER pH 6 retrieval is recommended |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DDX43 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DDX43. This antibody reacts with human. The DDX43 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DDX43 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GIDTAFQPSVGKDGSTDNNVVAGDRPLIDWDQIREEGLKWQKTKWADLPPIKKNFYKESTATSAMSKVEADSWR |
|---|
| Other Names | Cancer/testis antigen 13, CT13DEAD-box protein 43, DEAD (Asp-Glu-Ala-Asp) box polypeptide 43, DEAD box protein 43, DKFZp434H2114, EC 3.6.1, EC 3.6.4.13, HAGEDEAD box protein HAGE, Helical antigen, probable ATP-dependent RNA helicase DDX43 |
|---|
| Gene, Accession # | DDX43, Gene ID: 55510 |
|---|
| Catalog # | NBP1-85419 |
|---|
| Price | |
|---|
| Order / More Info | DDX43 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24755885 |
|---|
| 产品资料 |
|
|