| Edit |   |
| Antigenic Specificity | GPR87 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal anti-GPR87 antibody |
| Immunogen | The immunogen for anti-GPR87 antibody: synthetic peptide directed towards the N terminal of human GPR87. Synthetic peptide located within the following region: MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL |
| Other Names | GPR95, KPG_002, G protein-coupled receptor 87 |
| Gene, Accession # | GPR87, Accession: NM_023915 |
| Catalog # | TA329468 |
| Price | |
| Order / More Info | GPR87 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |