| Edit |   |
|---|
| Antigenic Specificity | Gpr88 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal anti-Gpr88 antibody |
|---|
| Immunogen | The immunogen for anti-Gpr88 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LYTWRNEEFRRSVRSVLPGVGDAAAAAAAATAVPAMSQAQLGTRAAGQHW |
|---|
| Other Names | STRG, G protein-coupled receptor 88 |
|---|
| Gene, Accession # | Gpr88, Accession: NM_031696 |
|---|
| Catalog # | TA329464 |
|---|
| Price | |
|---|
| Order / More Info | Gpr88 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|