| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MAD2L2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAD2L2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAD2L2. This antibody reacts with human. The MAD2L2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MAD2L2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVH |
|---|
| Other Names | hREV7, MAD2 mitotic arrest deficient-like 2 (yeast), MAD2BREV7 homolog, MAD2-like protein 2, Mitotic arrest deficient 2-like protein 2, mitotic arrest deficient homolog-like 2, mitotic spindle assembly checkpoint protein MAD2B, REV7yeast, homolog)-like 2 |
|---|
| Gene, Accession # | MAD2L2, Gene ID: 10459 |
|---|
| Catalog # | NBP2-58605 |
|---|
| Price | |
|---|
| Order / More Info | MAD2L2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|