| Edit |   |
|---|
| Antigenic Specificity | EYA3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | IHC,WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-EYA3 Antibody |
|---|
| Immunogen | The immunogen for anti-EYA3 antibody: synthetic peptide directed towards the middle region of human EYA3. Synthetic peptide located within the following region: QSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYA |
|---|
| Other Names | EYA transcriptional coactivator and phosphatase 3 |
|---|
| Gene, Accession # | EYA3, Accession: NM_001990 |
|---|
| Catalog # | TA330254 |
|---|
| Price | |
|---|
| Order / More Info | EYA3 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|