| Edit |   |
| Antigenic Specificity | Patched 2/PTCH2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Patched 2/PTCH2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Patched 2/PTCH2. This antibody reacts with human. The Patched 2/PTCH2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PTCH2(patched homolog 2 (Drosophila)) The peptide sequence was selected from the N terminal of PTCH2. Peptide sequence LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV. |
| Other Names | patched (Drosophila) homolog 2, patched 2, patched homolog 2, patched homolog 2 (Drosophila), protein patched homolog 2, PTC2 |
| Gene, Accession # | PTCH2, Gene ID: 8643, Accession: Q9Y6C5, SwissProt: Q9Y6C5 |
| Catalog # | NBP1-59457 |
| Price | |
| Order / More Info | Patched 2/PTCH2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |