| Edit |   |
| Antigenic Specificity | RNF121 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RNF121 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF121. This antibody reacts with human. The RNF121 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to RNF121(ring finger protein 121) The peptide sequence was selected from the middle region of RNF121. Peptide sequence GMPTKHLSDSVCAVCGQQIFVDVSEEGIIENTYRLSCNHVFHEFCIRGWC. |
| Other Names | FLJ11099, ring finger protein 121 |
| Gene, Accession # | RNF121, Gene ID: 55298, Accession: Q9H920, SwissProt: Q9H920 |
| Catalog # | NBP1-59638-20ul |
| Price | |
| Order / More Info | RNF121 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |