| Edit |   |
| Antigenic Specificity | RNF133 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RNF133 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF133. This antibody reacts with human. The RNF133 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to RNF133(ring finger protein 133) The peptide sequence was selected from the N terminal of RNF133. Peptide sequence VVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVIVPPEGKIQNA. |
| Other Names | E3 ubiquitin-protein ligase RNF133, EC 6.3.2.-, ring finger protein 133MGC27072 |
| Gene, Accession # | RNF133, Gene ID: 168433, Accession: Q8WVZ7, SwissProt: Q8WVZ7 |
| Catalog # | NBP1-62487 |
| Price | |
| Order / More Info | RNF133 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |