| Edit |   |
| Antigenic Specificity | TFPI-2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TFPI-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TFPI-2. This antibody reacts with human. The TFPI-2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
| Immunogen | Synthetic peptides corresponding to TFPI2(tissue factor pathway inhibitor 2) The peptide sequence was selected from the middle region of TFPI2. Peptide sequence NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT. |
| Other Names | Placental protein 5, PP5FLJ21164, TFPI-2REF1, tissue factor pathway inhibitor 2 |
| Gene, Accession # | TFPI2, Gene ID: 7980, Accession: P48307, SwissProt: P48307 |
| Catalog # | NBP1-57942 |
| Price | |
| Order / More Info | TFPI-2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |