| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TfR (Transferrin R) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TfR (Transferrin R) Antibody from Novus Biologicals is a rabbit polyclonal antibody to TfR (Transferrin R). This antibody reacts with human. The TfR (Transferrin R) Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TfR (Transferrin R)/CD71 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKV |
|---|
| Other Names | CD71 antigen, CD71TRFR, p90, T9, TfR, TFR1, TR, transferrin receptor (p90, CD71), transferrin receptor protein 1, Trfr |
|---|
| Gene, Accession # | TFRC, Gene ID: 7037 |
|---|
| Catalog # | NBP1-85741 |
|---|
| Price | |
|---|
| Order / More Info | TfR (Transferrin R) Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23991213, 26269133 |
|---|
| 产品资料 |
|
|