| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TFIIB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TFIIB Antibody from Novus Biologicals is a rabbit polyclonal antibody to TFIIB. This antibody reacts with human. The TFIIB Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human TFIIB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LPRDTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFG |
|---|
| Other Names | general transcription factor IIB, General transcription factor TFIIB, S300-II, TFIIBTF2BRNA polymerase II transcription factor IIB, transcription initiation factor IIB |
|---|
| Gene, Accession # | GTF2B, Gene ID: 2959, Accession: Q00403, SwissProt: Q00403 |
|---|
| Catalog # | NBP2-34143 |
|---|
| Price | |
|---|
| Order / More Info | TFIIB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|