| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HM74A/PUMA-G/GPR109A/NIACR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Western blot reported in scientific literature (PMID 25622782) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HM74A/PUMA-G/GPR109A/NIACR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HM74A/PUMA-G/GPR109A/NIACR1. This antibody reacts with human, rat. The HM74A/PUMA-G/GPR109A/NIACR1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HM74A/PUMA-G/GPR109A/NIACR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP |
|---|
| Other Names | GPR109A, HCA2, hydroxycarboxylic acid receptor 2, NIACR1 |
|---|
| Gene, Accession # | HCAR2, Gene ID: 338442, Accession: Q8TDS4, SwissProt: Q8TDS4 |
|---|
| Catalog # | NBP1-92180 |
|---|
| Price | |
|---|
| Order / More Info | HM74A/PUMA-G/GPR109A/NIACR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25622782, 26371038 |
|---|
| 产品资料 |
|
|