| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UBE2CBP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UBE2CBP Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBE2CBP. This antibody reacts with human. The UBE2CBP Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human UBE2CBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SLVIESLRNSKYIKKFPLLENTFKADSSSAWSAVKVLYQPCIKSRNEKLVSLWESDISVHPLTLPSATCLELLL |
|---|
| Other Names | C6orf157, chromosome 6 open reading frame 157, EC 6.3.2, EC 6.3.2.-, H10BHDKFZp434A1520, MGC126561, MGC126587, UBCH10 binding protein with a hect-like domain, UbcH10-binding protein with a HECT-like domain, ubiquitin-conjugating enzyme E2C binding protein, ubiquitin-conjugating enzyme E2C-binding protein, YJR141W |
|---|
| Gene, Accession # | UBE3D, Gene ID: 90025 |
|---|
| Catalog # | NBP1-86757 |
|---|
| Price | |
|---|
| Order / More Info | UBE2CBP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|