| Edit |   |
|---|
| Antigenic Specificity | UBE2DNL |
|---|
| Clone | 2F7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. This product is useful for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UBE2DNL Antibody (2F7) from Novus Biologicals is a mouse monoclonal antibody to UBE2DNL. This antibody reacts with human. The UBE2DNL Antibody (2F7) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | MGC42638 (AAH40290, 1 a.a. 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MALKLIHKEFLELARDPQPHCSAGPVWDDMLHWQATITRPNDSSYLGGVFFLKFPSDYLFKPPKIKFTNGIYHQR |
|---|
| Other Names | MGC42638, UBE2D2L, ubiquitin-conjugating enzyme E2D N-terminal like (pseudogene) |
|---|
| Gene, Accession # | UBE2DNL, Gene ID: 100131816, Accession: AAH40290, SwissProt: AAH40290 |
|---|
| Catalog # | H00340561-M01 |
|---|
| Price | |
|---|
| Order / More Info | UBE2DNL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|