| Edit |   |
| Antigenic Specificity | HDDC2 - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-HDDC2 Antibody - N-terminal region |
| Immunogen | The immunogen for Anti-HDDC2 antibody is: synthetic peptide directed towards the N-terminal region of Human HDDC2. Synthetic peptide located within the following region: ASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMY |
| Other Names | C6orf74, NS5ATP2, dJ167O5.2, HD domain containing 2 |
| Gene, Accession # | HDDC2, Accession: NM_016063 |
| Catalog # | TA344256 |
| Price | |
| Order / More Info | HDDC2 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |