| Edit |   |
| Antigenic Specificity | BLMH/Bleomycin Hydrolase |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The BLMH/Bleomycin Hydrolase Antibody from Novus Biologicals is a rabbit polyclonal antibody to BLMH/Bleomycin Hydrolase. This antibody reacts with human. The BLMH/Bleomycin Hydrolase Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to BLMH(bleomycin hydrolase) The peptide sequence was selected from the middle region of BLMH. Peptide sequence EYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKL. |
| Other Names | BHBMHBLM hydrolase, bleomycin hydrolase, EC 3.4.22.40 |
| Gene, Accession # | BLMH, Gene ID: 642, Accession: Q13867, SwissProt: Q13867 |
| Catalog # | NBP1-55141-20ul |
| Price | |
| Order / More Info | BLMH/Bleomycin Hydrolase Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |