| Edit |   |
|---|
| Antigenic Specificity | BLMH/Bleomycin Hydrolase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BLMH/Bleomycin Hydrolase Antibody from Novus Biologicals is a rabbit polyclonal antibody to BLMH/Bleomycin Hydrolase. This antibody reacts with human. The BLMH/Bleomycin Hydrolase Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to BLMH(bleomycin hydrolase) The peptide sequence was selected from the middle region of BLMH. Peptide sequence EYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKL. |
|---|
| Other Names | BHBMHBLM hydrolase, bleomycin hydrolase, EC 3.4.22.40 |
|---|
| Gene, Accession # | BLMH, Gene ID: 642, Accession: Q13867, SwissProt: Q13867 |
|---|
| Catalog # | NBP1-55141-20ul |
|---|
| Price | |
|---|
| Order / More Info | BLMH/Bleomycin Hydrolase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|