| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DPH3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DPH3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DPH3. This antibody reacts with human. The DPH3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DPH3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVK |
|---|
| Other Names | DelGEF-interacting protein 1, DELGIP, DelGIP1, DELGIP1deafness locus putative guanine nucleotide exchange factor interacting protein1, DESR1CSL-type zinc finger-containing protein 2, DPH3 homolog, DPH3 homolog (KTI11, S. cerevisiae), DPH3, KTI11 homolog (S. cerevisiae), DPH3A, DPH3A, KTI11 homolog A, KTI11Del-GEF interacting protein, MGC20197, ZCSL2diphtheria toxin and Pseudomonas exotoxin A sensitivity required gene 1, zinc finger, CSL domain containing 2, zinc finger, CSL-type containing 2 |
|---|
| Gene, Accession # | DPH3, Gene ID: 285381 |
|---|
| Catalog # | NBP1-84276 |
|---|
| Price | |
|---|
| Order / More Info | DPH3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|