| 产品详情 |
| Edit |   |
| Antigenic Specificity | DPH4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DPH4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DPH4. This antibody reacts with human. The DPH4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DPH4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHY |
| Other Names | CSL-type zinc finger-containing protein 3, DnaJ (Hsp40) homolog, subfamily C, member 24, dnaJ homolog subfamily C member 24, DPH4 homolog, DPH4, JJJ3 homolog, DPH4, JJJ3 homolog (S. cerevisiae), DPH41700030A21Rik, JJJ3, S. cerevisiae), ZCSL3, zinc finger, CSL domain containing 3, zinc finger, CSL-type containing 3 |
| Gene, Accession # | DNAJC24, Gene ID: 120526 |
| Catalog # | NBP1-87968 |
| Price | |
| Order / More Info | DPH4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|