| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | REV3L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The REV3L Antibody from Novus Biologicals is a rabbit polyclonal antibody to REV3L. This antibody reacts with human. The REV3L Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human REV3L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LHGIFPYLYVPYDGYGQQPESYLSQMAFSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKERHFMKIYLYNPTMVKRICE |
|---|
| Other Names | EC 2.7.7, EC 2.7.7.7, hREV3, Protein reversionless 3-like, REV3 (yeast homolog)-like, catalytic subunit of DNA polymerase zeta, REV3-like, REV3-like, catalytic subunit of DNA polymerase zeta (yeast), yeast, homolog-like (polymerase, DNA, zeta) |
|---|
| Gene, Accession # | REV3L, Gene ID: 5980 |
|---|
| Catalog # | NBP2-57595 |
|---|
| Price | |
|---|
| Order / More Info | REV3L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|