| Edit |   |
| Antigenic Specificity | YTHDF3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit polyclonal Anti-YTHDF3 Antibody |
| Immunogen | The immunogen for anti-YTHDF3 antibody: synthetic peptide directed towards the N terminal of human YTHDF3. Synthetic peptide located within the following region: GEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQ |
| Other Names | YTH domain family, member 3 |
| Gene, Accession # | YTHD3, Accession: NM_152758 |
| Catalog # | TA329787 |
| Price | |
| Order / More Info | YTHDF3 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |