| 产品详情 |
| Edit |   |
| Antigenic Specificity | Exosome component 10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Exosome component 10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Exosome component 10. This antibody reacts with human. The Exosome component 10 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human Exosome component 10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KVTELEDKFDLLVDANDVILERVGILLDEASGVNKNQQPVLPAGLQVPKTVVSSWNRKAAEYGKKAKSETFRLLHA |
| Other Names | autoantigen PM-SCL, EC 3.1.13.-, exosome component 10, P100 polymyositis-scleroderma overlap syndrome-associated autoantigen, p2, p3, p4, PM/Scl-100Autoantigen PM/Scl 2, PM-Scl, PMSCL2PMSCL, Polymyositis/scleroderma autoantigen 2, polymyositis/scleroderma autoantigen 2 (100kD), polymyositis/scleroderma autoantigen 2, 100kDa, RRP6, Rrp6p, RRP6Polymyositis/scleroderma autoantigen 100 kDa |
| Gene, Accession # | EXOSC10, Gene ID: 5394 |
| Catalog # | NBP1-82448 |
| Price | |
| Order / More Info | Exosome component 10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23435261 |
| 产品资料 |
|
|