| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Exosome component 10 |
|---|
| Clone | 1E6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Exosome component 10 Antibody (1E6) from Novus Biologicals is a mouse monoclonal antibody to Exosome component 10. This antibody reacts with human. The Exosome component 10 Antibody (1E6) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | EXOSC10 (NP_001001998.1, 1 a.a. - 99 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAPPSTREPRVLSATSATKSDGEMVLPGFPDADSFVKFALGSVVAVTKASGGLPQFGDEYDFYRSFPGFQAFCETQGDRLLQCMSRVMQYHGCRSNIKD |
|---|
| Other Names | autoantigen PM-SCL, EC 3.1.13.-, exosome component 10, P100 polymyositis-scleroderma overlap syndrome-associated autoantigen, p2, p3, p4, PM/Scl-100Autoantigen PM/Scl 2, PM-Scl, PMSCL2PMSCL, Polymyositis/scleroderma autoantigen 2, polymyositis/scleroderma autoantigen 2 (100kD), polymyositis/scleroderma autoantigen 2, 100kDa, RRP6, Rrp6p, RRP6Polymyositis/scleroderma autoantigen 100 kDa |
|---|
| Gene, Accession # | EXOSC10, Gene ID: 5394, Accession: NP_001001998, SwissProt: NP_001001998 |
|---|
| Catalog # | H00005394-M08 |
|---|
| Price | |
|---|
| Order / More Info | Exosome component 10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 21935888 |
|---|
| 产品资料 |
|
|