| 产品详情 |
| Edit |   |
| Antigenic Specificity | Exosome component 5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Exosome component 5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Exosome component 5. This antibody reacts with human. The Exosome component 5 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Exosome component 5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEI |
| Other Names | CML28, exosome complex exonuclease RRP46, exosome component 5Chronic myelogenous leukemia tumor antigen 28, exosome component Rrp46, hRrp46p, MGC12901, p12BMGC111224, RRP41B, Rrp46p, RRP46Ribosomal RNA-processing protein 46 |
| Gene, Accession # | EXOSC5, Gene ID: 56915 |
| Catalog # | NBP2-56887 |
| Price | |
| Order / More Info | Exosome component 5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|