| Edit |   |
|---|
| Antigenic Specificity | Ocular development associated gene |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ocular development associated gene Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ocular development associated gene. This antibody reacts with human. The Ocular development associated gene Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Ocular development associated gene antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGR |
|---|
| Other Names | FLJ22489, GATA zinc finger domain containing 1, GATA zinc finger domain-containing protein 1, ocular development associated, Ocular development-associated gene protein, ODAGFLJ40695, RG083M05.2 |
|---|
| Gene, Accession # | GATAD1, Gene ID: 57798 |
|---|
| Catalog # | NBP2-57351 |
|---|
| Price | |
|---|
| Order / More Info | Ocular development associated gene Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|