| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Odf1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunofluorescence. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western blot data from the Independent Validation Initiative at antibodies-online.com. Reported ICC-IF application. Data from the Independent Validation Initiative at antibodies-online.com. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Odf1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Odf1. This antibody reacts with human, mouse. The Odf1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunofluorescence. Specificity of human Odf1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDC |
|---|
| Other Names | cancer/testis antigen 133, CT133, HSPB10, MGC129928, MGC129929, ODF, ODF2, ODF27, ODFP, ODFPG, ODFPGA, ODFPGB, outer dense fiber of sperm tails 1, outer dense fiber of sperm tails, 27-kD, outer dense fiber protein 1, outer dense fibre of sperm tails 1, RT7, SODF |
|---|
| Gene, Accession # | ODF1, Gene ID: 4956, Accession: Q14990, SwissProt: Q14990 |
|---|
| Catalog # | NBP2-38050 |
|---|
| Price | |
|---|
| Order / More Info | Odf1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|