| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ODF2 |
|---|
| Clone | 1A1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, C. elegans |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. ICC/IF usage reported in scientific literature. IHC usage reported in scientific literature (PMID: 24231678). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ODF2 Antibody (1A1) from Novus Biologicals is a mouse monoclonal antibody to ODF2. This antibody reacts with human, c. elegans. The ODF2 Antibody (1A1) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | ODF2 (NP_002531.3 706 a.a. - 804 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP |
|---|
| Other Names | Cenexin, FLJ44866, MGC111096, MGC9034, ODF2/1, ODF2/2, ODF8484-kD, outer dense fiber of sperm tails 2, outer dense fiber protein 2, sperm tail structural protein |
|---|
| Gene, Accession # | ODF2, Gene ID: 4957, Accession: NP_002531, SwissProt: NP_002531 |
|---|
| Catalog # | H00004957-M01 |
|---|
| Price | |
|---|
| Order / More Info | ODF2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23064640, 23348840, 24231678, 24434581, 24882706, 26166481, 26916822 |
|---|
| 产品资料 |
|
|