| Edit |   |
| Antigenic Specificity | ODF3L1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ODF3L1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ODF3L1. This antibody reacts with human. The ODF3L1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ODF3L1(outer dense fiber of sperm tails 3-like 1) The peptide sequence was selected from the N terminal of ODF3L1. Peptide sequence KLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSC. |
| Other Names | MGC48986, outer dense fiber of sperm tails 3-like 1, outer dense fiber protein 3-like protein 1 |
| Gene, Accession # | ODF3L1, Gene ID: 161753, Accession: Q8IXM7, SwissProt: Q8IXM7 |
| Catalog # | NBP1-56392-20ul |
| Price | |
| Order / More Info | ODF3L1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |