| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ODR4/TTG1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ODR4/TTG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ODR4/TTG1. This antibody reacts with human, mouse. The ODR4/TTG1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse ODR4/TTG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FHVLPYRVFVPLPGSTVMLCDYKFDDESAEEIRDHFMEMLDHTIQIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPIK |
|---|
| Other Names | chromosome 1 open reading frame 27, FLJ20505, hODR-4, LAG1-interacting protein, odorant response abnormal 4, odr-4, ODR4, protein odr-4 homolog, Transactivated by transforming growth factor beta protein 1, TTG1, TTG1A |
|---|
| Gene, Accession # | C1ORF27, Gene ID: 54953 |
|---|
| Catalog # | NBP1-82177 |
|---|
| Price | |
|---|
| Order / More Info | ODR4/TTG1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|