| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ODZ3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ODZ3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ODZ3. This antibody reacts with human. The ODZ3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ODZ3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EPSYELVKSQQWDDIPPIFGVQQQVARQAKAFLSLGKMAEVQVSRRRAGG AQSWLWFATVKSLIGKGVMLAVSQGRVQTNVLN |
|---|
| Other Names | FLJ10474, FLJ10886, KIAA1455odd Oz/Ten-m homolog 3, odz, odd Oz/ten-m homolog 3 (Drosophila), ODZ3-like protein, Protein Odd Oz/ten-m homolog 3, ten-3, tenascin-M3, teneurin-3, Ten-m3, TNM3 |
|---|
| Gene, Accession # | TENM3, Gene ID: 55714 |
|---|
| Catalog # | NBP2-13687 |
|---|
| Price | |
|---|
| Order / More Info | ODZ3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|