| Edit |   |
|---|
| Antigenic Specificity | TMEM16K |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM16K Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM16K. This antibody reacts with human. The TMEM16K Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TMEM16K(transmembrane protein 16K) The peptide sequence was selected from the C terminal of TMEM16K. Peptide sequence LKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAA. |
|---|
| Other Names | anoctamin 10, FLJ10375, MGC47890, Transmembrane protein 16KTMEM16Kanoctamin-10 |
|---|
| Gene, Accession # | ANO10, Gene ID: 55129, Accession: Q9NW15, SwissProt: Q9NW15 |
|---|
| Catalog # | NBP1-59667 |
|---|
| Price | |
|---|
| Order / More Info | TMEM16K Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|