| Edit |   |
| Antigenic Specificity | VHLL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-VHLL Antibody |
| Immunogen | The immunogen for Anti-VHLL antibody is: synthetic peptide directed towards the N-terminal region of Human VHLL. Synthetic peptide located within the following region: PWRAGNGVGLEAQAGTQEAGPEEYCQEELGAEEEMAARAAWPVLRSVNSR |
| Other Names | VHLP, VLP, von Hippel-Lindau tumor suppressor-like |
| Gene, Accession # | VHLL, Accession: NM_001004319 |
| Catalog # | TA330819 |
| Price | |
| Order / More Info | VHLL Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |