| 产品详情 |
| Edit |   |
| Antigenic Specificity | CMAS |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CMAS Antibody from Novus Biologicals is a rabbit polyclonal antibody to CMAS. This antibody reacts with human. The CMAS Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CMAS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KMEVSVSDKLAVVDEWRKEMGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCNGGRGAIREFAEHICLLMEKVNNSCQ |
| Other Names | CMP-N-acetylneuraminic acid synthase, CMP-N-acetylneuraminic acid synthetase, CMP-Neu5Ac synthetase, CMP-NeuNAc synthase, CMP-NeuNAc synthetase, cytidine 5'-monophosphate N-acetylneuraminic acid synthetase, cytidine monophosphate N-acetylneuraminic acid synthetase, EC 2.7.7.43, N-acylneuraminate cytidylyltransferase |
| Gene, Accession # | CMAS, Gene ID: 55907 |
| Catalog # | NBP1-85858 |
| Price | |
| Order / More Info | CMAS Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|