| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MMP-11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MMP-11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MMP-11. This antibody reacts with human. The MMP-11 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MMP-11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EFGHVLGLQHTTAAKALMSAFYTFRYPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA |
|---|
| Other Names | EC 3.4.24, EC 3.4.24.-, EC 3.4.24.24, matrix metallopeptidase 11 (stromelysin 3), matrix metalloproteinase 11 (stromelysin 3), Matrix metalloproteinase-11, MMP-11, SL-3, ST3, STMY3stromelysin 3, stromelysin III, stromelysin-3 |
|---|
| Gene, Accession # | MMP11, Gene ID: 4320 |
|---|
| Catalog # | NBP2-49575 |
|---|
| Price | |
|---|
| Order / More Info | MMP-11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|