| 产品详情 |
| Edit |   |
| Antigenic Specificity | FEM1B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FEM1B Antibody from Novus Biologicals is a rabbit polyclonal antibody to FEM1B. This antibody reacts with human. The FEM1B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FEM1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RFAQVFSQMIHLNETVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIH |
| Other Names | DKFZp451E0710, F1AA, F1A-ALPHA, FEM-1 (C.elegans) homolog b, fem-1 homolog b (C. elegans), FEM1b, FEM1-beta, FEM-1-like death receptor binding protein, Fem-1-like death receptor-binding protein alpha, Fem-1-like in apoptotic pathway protein alpha, FIAA, KIAA0396, protein fem-1 homolog B |
| Gene, Accession # | FEM1B, Gene ID: 10116 |
| Catalog # | NBP1-86219 |
| Price | |
| Order / More Info | FEM1B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|