| Edit |   |
|---|
| Antigenic Specificity | SNX17 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SNX17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SNX17. This antibody reacts with human. The SNX17 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SNX17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GTLRRSDSQQAVKSPPLLESPDATRESMVKLSSKLSAVSLRGIGSPSTDASASDVHGNFAFEGIGDEDL |
|---|
| Other Names | KIAA0064sorting nexin-17, sorting nexin 17 |
|---|
| Gene, Accession # | SNX17, Gene ID: 9784 |
|---|
| Catalog # | NBP1-92417 |
|---|
| Price | |
|---|
| Order / More Info | SNX17 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|