| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | VCIP135/VCPIP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VCIP135/VCPIP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VCIP135/VCPIP1. This antibody reacts with human. The VCIP135/VCPIP1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human VCIP135/VCPIP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLCGALSELHVPPEWLAPGGKLYNLAKSTHGQLRTDKNYSFPLNNLVCSY DSVKDVLVPDYGMSNLTACNWCHGTSVRKVRGDGSIVYLDG |
|---|
| Other Names | DKFZp686G038, DUBA3, EC 3.4.22.-, FLJ23132, KIAA1850FLJ60694, valosin containing protein (p97)/p47 complex interacting protein 1, valosin-containing protein (p97)/p47 complex-interacting protein p135, Valosin-containing protein p97/p47 complex-interacting protein 1, Valosin-containing protein p97/p47 complex-interacting protein p135, VCIP135deubiquitinating protein VCIP135, VCPIP1 VCIP135 |
|---|
| Gene, Accession # | VCPIP1, Gene ID: 80124 |
|---|
| Catalog # | NBP2-13515 |
|---|
| Price | |
|---|
| Order / More Info | VCIP135/VCPIP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|