| Edit |   |
|---|
| Antigenic Specificity | COX7B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The COX7B Antibody from Novus Biologicals is a rabbit polyclonal antibody to COX7B. This antibody reacts with human. The COX7B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to COX7B (cytochrome c oxidase subunit VIIb) The peptide sequence was selected from the N terminal of COX7B. Peptide sequence MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCI. |
|---|
| Other Names | Cytochrome c oxidase polypeptide VIIb, cytochrome c oxidase subunit 7B, mitochondrial, cytochrome c oxidase subunit VIIb, cytochrome-c oxidase chain VIIb |
|---|
| Gene, Accession # | COX7B, Gene ID: 1349, Accession: P24311, SwissProt: P24311 |
|---|
| Catalog # | NBP1-57028-20ul |
|---|
| Price | |
|---|
| Order / More Info | COX7B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|